15 June 2013

Dear editors,...

Here is a screenshot of Thunderbird with the RSS feeds for "NCBI/pubmed: Exome Sequencing".


I'm pretty sure that all that (semantic) information is lost.

Dear editors, could you please ask the authors to complete or create an article in wikipedia about their paper once you have published it (possibly using a semantic template ?).

Thank you,

Pierre

See also We found a gene involved in a genetic disease. Now, what is the TODO list ?

09 June 2013

How to fit a sentence in a rectangle with the Hershey vectorial font.

via wikipedia: The Hershey fonts are a collection of vector fonts developed circa 1967 by Dr. A. V. Hershey (...). Vector fonts are easily scaled and rotated in two or three dimensions; consequently the Hershey fonts have been widely used in computer graphics and computer-aided design programs.. When programming, I often have to fit a sentence in a rectangle (for example to write the name of a short-read in the graphical view of a BAM) so I wrote a XML version of the hershey font.

<?xml version="1.0"?>
<hershey>
  <letter id="1" count="9" left="-5" right="5" char="a">
    <moveto x="0" y="-5"/>
    <lineto x="-4" y="4"/>
    <moveto x="0" y="-5"/>
    <lineto x="4" y="4"/>
    <moveto x="-2" y="1"/>
    <lineto x="2" y="1"/>
  </letter>
  <letter id="2" count="16" left="-5" right="5" char="b">
    <moveto x="-3" y="-5"/>
    <lineto x="-3" y="4"/>
    <moveto x="-3" y="-5"/>
    <lineto x="1" y="-5"/>
    <lineto x="3" y="-4"/>
    <lineto x="3" y="-2"/>
    <lineto x="1" y="-1"/>
    <moveto x="-3" y="-1"/>
    <lineto x="1" y="-1"/>
    <lineto x="3" y="0"/>
    <lineto x="3" y="3"/>
From there, I can generate some bindings
for various programming languages using XSLT, for example javascript:
{
 "1":[{t:'M',x:0,y:-5},{t:'L',x:-4,y:4},{t:'M',x:0,y:-5},{t:'L',x:4,y:4},{t:'M',x:-2,y:1},{t:'L',x:2,y:1}],
 "2":[{t:'M',x:-3,y:-5},{t:'L',x:-3,y:4},{t:'M',x:-3,y:-5},{t:'L',x:1,y:-5},{t:'L',x:3,y:-4},{t:'L',x:3,y:-2},{t:'L',x:1,y:-1},{t:'M',x:-3,y:-1},{t:'L',x:1,y:-1},{t:'L',x:3,y:0},{t:'L',x:3,y:3},{t:'L',x:1,y:4},{t:'L',x:-3,y:4}], ...

In the Javascript example below, I'm generating some random rectangles where a sentence is written:


That's it,
Pierre

29 May 2013

Binding a C library with Javascript/ #mozilla. An example with the Tabix library

In this post I'll show how to bind a C API to javascript using the mozilla/xul-runner API and the tabix library.

About xpcshell

XULRunner is a Mozilla runtime package. The SDK package contains xpcshell, a JavaScript Shell application that lets you run JavaScript code. "Unlike the ordinary JS shell (js), xpcshell lets the scripts running in it access the mozila technologies (XPCOM)." I've tested the current code with
$ xulrunner -v
Mozilla XULRunner 22.0 - 20130521223249
XULRunner is not installed by default on ubuntu on needs to be downloaded.

The js.type library

The js-ctypes is a foreign-function library for Mozilla's privileged JavaScript. It provides C-compatible data types and allows JS code to call functions in shared libraries (dll, so, dylib) and implement callback functions.

Tabix

Heng Li's Tabix is "a generic tool that indexes position sorted files in TAB-delimited formats such as GFF, BED, PSL, SAM and SQL export, and quickly retrieves features overlapping specified regions.". The code is available in github at https://github.com/samtools/tabix.

Binding the Tabix library to javascript

First of all, the dynamic library for tabix must be compiled:
$ cd /path/to/tabix.dir
$ make libtabix.so.1
A javascript file tabix.js is created. At the top, we tell the javascrpipt engine we want to use the js.type library:
Components.utils.import("resource://gre/modules/ctypes.jsm")
The dynamic library for tabix is loaded:
var lib = ctypes.open("libtabix.so.1");
We bind each required methods of the tabix library to javascript. As an example we're going to bind ti_open. The C declaration for this method is:
tabix_t *ti_open(const char *fn, const char *fnidx);
Using js.type, the call to that method is wrapped to javascript using declare/:
var DLOpen= lib.declare("ti_open",/* method name */
 ctypes.default_abi,/* Application binary interface type */
 ctypes.voidptr_t, /* return type is a pointer 'void*' */
 ctypes.char.ptr,  /* first argument is 'char*' */
 ctypes.int32_t /* second argument is 'int' */
 );
In javascript, the library is used by invoking DLOpen :
function TabixFile(filename)
 {
 this.ptr= DLOpen(filename,0);
 if(this.ptr.isNull()) throw "I/O ERROR: Cannot open \""+filename+"\"";
 };
var tabix=new TabixFile("annotatons.bed.gz");

The tabix.js library

All in one, I wrote the following file.

Testing


load("tabix.js");
var tabix=new TabixFile("/path/to/tabix-0.2.5/example.gtf.gz");
var iter=tabix.query("chr2:32800-35441");
while((line=iter.next())!=null)
 {
 print(line);
 }
tabix.close();

Set the dynamic library path (LD_LIBRARY_PATH) and invoke this script with xpcshell:
LD_LIBRARY_PATH=/path/to/xulrunner-sdk/bin:/path/to/tabix-0.2.5 /path/to/xulrunner-sdk/bin/xpcshell -f test.js
Output:
chr2 HAVANA transcript 28814 36385 . - . gene_id "ENSG00000184731"; transcript_id "ENST00000327669"; gene_type "protein_coding"; gene_status "KNOWN"; gene_name "FAM110C"; transcript_type "protein_coding"; transcript_status "KNOWN"; transcript_name "FAM110C-001"; level 2; tag "CCDS"; ccdsid "CCDS42645"; havana_gene "OTTHUMG00000151321"; havana_transcript "OTTHUMT00000322220";
chr2 HAVANA gene 28814 36870 . - . gene_id "ENSG00000184731"; transcript_id "ENSG00000184731"; gene_type "protein_coding"; gene_status "KNOWN"; gene_name "FAM110C"; transcript_type "protein_coding"; transcript_status "KNOWN"; transcript_name "FAM110C"; level 2; havana_gene "OTTHUMG00000151321";
chr2 HAVANA transcript 31220 32952 . - . gene_id "ENSG00000184731"; transcript_id "ENST00000460464"; gene_type "protein_coding"; gene_status "KNOWN"; gene_name "FAM110C"; transcript_type "processed_transcript"; transcript_status "KNOWN"; transcript_name "FAM110C-003"; level 2; havana_gene "OTTHUMG00000151321"; havana_transcript "OTTHUMT00000322222";
chr2 HAVANA transcript 31221 36870 . - . gene_id "ENSG00000184731"; transcript_id "ENST00000461026"; gene_type "protein_coding"; gene_status "KNOWN"; gene_name "FAM110C"; transcript_type "processed_transcript"; transcript_status "KNOWN"; transcript_name "FAM110C-002"; level 2; havana_gene "OTTHUMG00000151321"; havana_transcript "OTTHUMT00000322221";
chr2 HAVANA exon 32809 32952 . - . gene_id "ENSG00000184731"; transcript_id "ENST00000460464"; gene_type "protein_coding"; gene_status "KNOWN"; gene_name "FAM110C"; transcript_type "processed_transcript"; transcript_status "KNOWN"; transcript_name "FAM110C-003"; level 2; havana_gene "OTTHUMG00000151321"; havana_transcript "OTTHUMT00000322222";
chr2 HAVANA CDS 35440 36385 . - 0 gene_id "ENSG00000184731"; transcript_id "ENST00000327669"; gene_type "protein_coding"; gene_status "KNOWN"; gene_name "FAM110C"; transcript_type "protein_coding"; transcript_status "KNOWN"; transcript_name "FAM110C-001"; level 2; tag "CCDS"; ccdsid "CCDS42645"; havana_gene "OTTHUMG00000151321"; havana_transcript "OTTHUMT00000322220";
chr2 HAVANA exon 35440 36385 . - . gene_id "ENSG00000184731"; transcript_id "ENST00000327669"; gene_type "protein_coding"; gene_status "KNOWN"; gene_name "FAM110C"; transcript_type "protein_coding"; transcript_status "KNOWN"; transcript_name "FAM110C-001"; level 2; tag "CCDS"; ccdsid "CCDS42645"; havana_gene "OTTHUMG00000151321"; havana_transcript "OTTHUMT00000322220";

That's it,

Pierre

26 May 2013

Filtering a VCF with javascript

This is my answer for that question on biostar. I wrote a java program filtering the VCF with the rhino javascript-engine.
I put the code on github: see https://github.com/lindenb/jvarkit#-filtering-vcf-with-javascript-rhino-.

For each variation, the script binds the following variables:

  • variant : the current variation; a org.broadinstitute.variant.variantcontext.VariantContext ( http://sourceforge.net/p/picard/code/HEAD/tree/trunk/src/java/org/broadinstitute/variant/variantcontext/VariantContext.java )
  • header : the VCF header org.broadinstitute.variant.vcf.VCFHeader ( http://sourceforge.net/p/picard/code/HEAD/tree/trunk/src/java/org/broadinstitute/variant/vcf/VCFHeader.java).
and evaluate the user script. This user script should return '1' or true if the current VCF file should be printed.

For example, you want to keep the variants having at least two samples having a depth (DP) greater that 200.
The script would be:
function myfilterFunction()
    {
    var samples=header.genotypeSamples;
    var countOkDp=0;
    for(var i=0; i< samples.size();++i)
        {
        var sampleName=samples.get(i);
        if(! variant.hasGenotype(sampleName)) continue;
        var genotype = variant.genotypes.get(sampleName);
        if( ! genotype.hasDP()) continue;
        var dp= genotype.getDP();
        if(dp < 200 ) countOkDp++;
        }
    return (countOkDp>2)
    }
myfilterFunction();

Example:

curl -s "https://raw.github.com/jamescasbon/PyVCF/master/vcf/test/gatk.vcf" |\
java -jar  dist/vcffilterjs.jar  -f filter.js |\
grep -v "##"


#CHROM POS ID REF ALT QUAL FILTER INFO FORMAT BLANK NA12878 NA12891 NA12892 NA19238 NA19239 NA19240
chr22 42526449 . T A 151.47 . AC=1;AF=0.071;AN=14;BaseQRankSum=2.662;DP=1226;DS;Dels=0.00;FS=0.000;HRun=0;HaplotypeScore=41.2083;MQ=240.47;MQ0=0;MQRankSum=0.578;QD=4.89;ReadPosRankSum=3.611 GT:AD:DP:GQ:PL 0/1:23,8:31:99:190,0,694 0/0:188,0:190:99:0,478,5376 0/0:187,0:187:99:0,493,5322 0/0:247,0:249:99:0,634,6728 0/0:185,0:185:99:0,487,5515 0/0:202,0:202:99:0,520,5857 0/0:181,1:182:99:0,440,5362
chr22 42526634 . T C 32.60 . AC=1;AF=0.071;AN=14;BaseQRankSum=1.147;DP=1225;DS;Dels=0.00;FS=0.000;HRun=0;HaplotypeScore=50.0151;MQ=240.65;MQ0=0;MQRankSum=1.151;QD=1.30;ReadPosRankSum=1.276 GT:AD:DP:GQ:PL 0/1:21,4:25:71:71,0,702 0/0:187,2:189:99:0,481,6080 0/0:233,0:233:99:0,667,7351 0/0:230,0:230:99:0,667,7394 0/0:174,1:175:99:0,446,5469 0/0:194,2:196:99:0,498,6239 0/0:174,0:175:99:0,511,5894
chr22 42527793 rs1080989 C T 3454.66 . AC=2;AF=0.167;AN=12;BaseQRankSum=-3.007;DB;DP=1074;DS;Dels=0.01;FS=0.000;HRun=1;HaplotypeScore=75.7865;MQ=209.00;MQ0=0;MQRankSum=3.014;QD=9.36;ReadPosRankSum=0.618 GT:AD:DP:GQ:PL ./. 0/1:72,90:162:99:1699,0,1767 0/1:103,96:202:99:1756,0,2532 0/0:188,0:188:99:0,526,5889 0/0:160,0:160:99:0,457,4983 0/0:197,0:198:99:0,544,6100 0/0:156,0:156:99:0,439,5041

That's it,

Pierre

24 May 2013

A Tribble/FeatureCodec handling JSON-based annotations files.

I wrote a java FeatureCodec for JSON with a the tribble library.
Citing the GATK tream: "The Tribble project was started as an effort to overhaul our reference-ordered data system; we had many different formats that were shoehorned into a common framework that didn't really work as intended. What we wanted was a common framework that allowed for searching of reference ordered data, regardless of the underlying type. Jim Robinson had developed indexing schemes for text-based files, which was incorporated into the Tribble library."".

The library is available at:https://github.com/lindenb/jsontribble.


The library contains the tools to sort, index and query the json file.

As a proof of concept, I also created a REST-based service to query those files.

REST/JSON

For example http://localhost:8080/jsontribble/rest/tribble/resources/dbsnp/annotations.json?chrom=chr1&start=881826&end=981826 returns:
{"header":{"description":"UCSC  snp137: select count(*) from snp137 where FIND_IN_SET(func,\"missense\")>0 and avHet>0.1"}
,"features":[
{"chrom":"chr1","start":881826,"end":881827,"name":"rs112341375","score":0,"strand":"+","refNCBI":"G","refUCSC":"G","observed":"C/G","class":"single","valid":["by-frequency"],"avHet":0.5,"func":["missense"],"submitters":["BUSHMAN"]}
{"chrom":"chr1","start":897119,"end":897120,"name":"rs28530579","score":0,"strand":"+","refNCBI":"G","refUCSC":"G","observed":"C/G","class":"single","valid":["unknown"],"avHet":0.375,"func":["missense"],"submitters":["ABI","ENSEMBL","SSAHASNP"]}
{"chrom":"chr1","start":907739,"end":907740,"name":"rs112235940","score":0,"strand":"+","refNCBI":"G","refUCSC":"G","observed":"A/G","class":"single","valid":["unknown"],"avHet":0.5,"func":["missense"],"submitters":["COMPLETE_GENOMICS"]}
{"chrom":"chr1","start":949607,"end":949608,"name":"rs1921","score":0,"strand":"+","refNCBI":"G","refUCSC":"G","observed":"A/C/G","class":"single","valid":["by-cluster","by-frequency","by-1000genomes"],"avHet":0.464348,"func":["missense"],"submitters":["1000GENOMES","AFFY","BGI","BUSHMAN","CGAP-GAI","CLINSEQ_SNP","COMPLETE_GENOMICS","CORNELL","DEBNICK","EXOME_CHIP","GMI","HGSV","ILLUMINA","ILLUMINA-UK","KRIBB_YJKIM","LEE","MGC_GENOME_DIFF","NHLBI-ESP","SC_JCM","SC_SNP","SEATTLESEQ","SEQUENOM","UWGC","WIAF","YUSUKE"],"bitfields":["maf-5-some-pop","maf-5-all-pops"]}
]}

REST/XML

Example http://localhost:8080/jsontribble/rest/tribble/resources/dbsnp/annotations.xml?chrom=chr1&start=897119&end=981826
<?xml version="1.0" encoding="UTF-8"?>
<annotations chrom="chr1" start="897119" end="981826">
  <header>
    <description>UCSC  snp137: select count(*) from snp137 where FIND_IN_SET(func,"missense")&gt;0 and avHet&gt;0.1</description>
  </header>
  <features>
    <feature>
      <chrom>chr1</chrom>
      <start type="integer">897119</start>
      <end type="integer">897120</end>
      <name>rs28530579</name>
      <score type="integer">0</score>
      <strand>+</strand>
      <refNCBI>G</refNCBI>
      <refUCSC>G</refUCSC>
      <observed>C/G</observed>
      <class>single</class>
      <valid>

BED/text

Example: http://localhost:8080/jsontribble/rest/tribble/resources/merge/annotations.bed?chrom=chr1&start=897119&end=981826.
chr1    895966  901099  {"chrom":"chr1","start":895966,"end":901099,"strand":"+","name":"uc001aca.2","cds...
chr1    896828  897858  {"chrom":"chr1","start":896828,"end":897858,"strand":"+","name":"uc001acb.1","cds...
chr1    897008  897858  {"chrom":"chr1","start":897008,"end":897858,"strand":"+","name":"uc010nya.1","cds...
chr1    897119  897120  {"chrom":"chr1","start":897119,"end":897120,"name":"rs28530579","score":0,"strand...
chr1    897734  899229  {"chrom":"chr1","start":897734,"end":899229,"strand":"+","name":"uc010nyb.1","cds...
chr1    901876  910484  {"chrom":"chr1","start":901876,"end":910484,"strand":"+","name":"uc001acd.3","cds...
chr1    901876  910484  {"chrom":"chr1","start":901876,"end":910484,"strand":"+","name":"uc001ace.3","cds...
chr1    901876  910484  {"chrom":"chr1","start":901876,"end":910484,"strand":"+","name":"uc001acf.3","cds...
chr1    907739  907740  {"chrom":"chr1","start":907739,"end":907740,"name":"rs112235940","score":0,"stran...
chr1    910578  917473  {"chrom":"chr1","start":910578,"end":917473,"strand":"-","name":"uc001ach.2","cds...
chr1    934341  935552  {"chrom":"chr1","start":934341,"end":935552,"strand":"-","name":"uc001aci.2","cds...
chr1    934341  935552  {"chrom":"chr1","start":934341,"end":935552,"strand":"-","name":"uc010nyc.1","cds...
chr1    948846  949919  {"chrom":"chr1","start":948846,"end":949919,"strand":"+","name":"uc001acj.4","cds...
chr1    949607  949608  {"chrom":"chr1","start":949607,"end":949608,"name":"rs1921","score":0,"strand":"+...
chr1    955502  991499  {"chrom":"chr1","start":955502,"end":991499,"strand":"+","name":"uc001ack.2","cds...

22 May 2013

Drawing a Timeline with jquery.

In 2008, I wrote a XUL-based interface displaying a timeline (http://...freebase-and-history-of-sciences.html).
History of Sciences / Freebase
Here I've played with jquery to display another timeline:

html

There is no json data: everyting is stored in the HTML. The years are surrounded by a <span/> element having a css class "start/end".


javascript

We use jquery to sort and layout each event.

CSS

A basic CSS for my timeline

Result


It's far from being perfect. I don't know how to handle the images overflowing the "div".

That's it,

Pierre


15 May 2013

VIZBAM and NGSProject

FYI: I've started the following projects on github:

VizBam

Vizbam ( https://github.com/lindenb/vizbam ) is a java library used to display a SAM alignment just like samtools tview

NGSProject

NGSProject ( https://github.com/lindenb/ngsproject ) is a java web-server used to display some SAM-records and SAM some alignments.

Screentshot







That's it,

Pierre

01 May 2013

Inserting the result of a BLAST into a Database using XSLT.

Here is the XML output of a BLAST:

<?xml version="1.0"?>
<!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN" "NCBI_BlastOutput.dtd">
<BlastOutput>
  <BlastOutput_program>tblastn</BlastOutput_program>
  <BlastOutput_version>TBLASTN 2.2.27+</BlastOutput_version>
  <BlastOutput_reference>Stephen F. Altschul, Thomas L. Madden, Alejandro A. Sch&amp;auml;ffer, Jinghui Z
hang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), &quot;Gapped BLAST and PSI-BLAST: a new generation 
of protein database search programs&quot;, Nucleic Acids Res. 25:3389-3402.</BlastOutput_reference>
  <BlastOutput_db>nr</BlastOutput_db>
  <BlastOutput_query-ID>52385</BlastOutput_query-ID>
  <BlastOutput_query-def>myseq</BlastOutput_query-def>
  <BlastOutput_query-len>30</BlastOutput_query-len>
  <BlastOutput_param>
    <Parameters>
      <Parameters_matrix>BLOSUM62</Parameters_matrix>
      <Parameters_expect>10</Parameters_expect>
      <Parameters_gap-open>11</Parameters_gap-open>
      <Parameters_gap-extend>1</Parameters_gap-extend>
      <Parameters_filter>L;</Parameters_filter>
    </Parameters>
  </BlastOutput_param>
<BlastOutput_iterations>
<Iteration>
  <Iteration_iter-num>1</Iteration_iter-num>
  <Iteration_query-ID>52385</Iteration_query-ID>
  <Iteration_query-def>myseq</Iteration_query-def>
  <Iteration_query-len>30</Iteration_query-len>
<Iteration_hits>
<Hit>
  <Hit_num>1</Hit_num>
  <Hit_id>gi|110624327|dbj|AK225891.1|</Hit_id>
  <Hit_def>Homo sapiens mRNA for zinc finger CCCH-type containing 7B variant, clone: FCC121C02</Hit_def>
  <Hit_accession>AK225891</Hit_accession>
  <Hit_len>1829</Hit_len>
  <Hit_hsps>
    <Hsp>
      <Hsp_num>1</Hsp_num>
      <Hsp_bit-score>62.3882</Hsp_bit-score>
      <Hsp_score>150</Hsp_score>
      <Hsp_evalue>4.01658e-10</Hsp_evalue>
      <Hsp_query-from>1</Hsp_query-from>
      <Hsp_query-to>30</Hsp_query-to>
      <Hsp_hit-from>250</Hsp_hit-from>
      <Hsp_hit-to>339</Hsp_hit-to>
      <Hsp_query-frame>0</Hsp_query-frame>
      <Hsp_hit-frame>1</Hsp_hit-frame>
      <Hsp_identity>30</Hsp_identity>
      <Hsp_positive>30</Hsp_positive>
      <Hsp_gaps>0</Hsp_gaps>
      <Hsp_align-len>30</Hsp_align-len>
      <Hsp_qseq>MERQKRKADIEKGLQFIQSTLPLKQEEYEA</Hsp_qseq>
      <Hsp_hseq>MERQKRKADIEKGLQFIQSTLPLKQEEYEA</Hsp_hseq>
      <Hsp_midline>MERQKRKADIEKGLQFIQSTLPLKQEEYEA</Hsp_midline>
    </Hsp>
  </Hit_hsps>
</Hit>
<Hit>
  <Hit_num>2</Hit_num>
  <Hit_id>gi|6176337|gb|AF188530.1|AF188530</Hit_id>
  <Hit_def>Homo sapiens ubiquitous tetratricopeptide containing protein RoXaN mRNA, partial cds</Hit_def&g
t;
  <Hit_accession>AF188530</Hit_accession>
  <Hit_len>2398</Hit_len>
  <Hit_hsps>
    <Hsp>
      <Hsp_num>1</Hsp_num>
      <Hsp_bit-score>62.3882</Hsp_bit-score>
      <Hsp_score>150</Hsp_score>
      <Hsp_evalue>4.12279e-10</Hsp_evalue>
      <Hsp_query-from>1</Hsp_query-from>
      <Hsp_query-to>30</Hsp_query-to>
      <Hsp_hit-from>105</Hsp_hit-from>
      <Hsp_hit-to>194</Hsp_hit-to>
      <Hsp_query-frame>0</Hsp_query-frame>
      <Hsp_hit-frame>3</Hsp_hit-frame>
      <Hsp_identity>30</Hsp_identity>
      <Hsp_positive>30</Hsp_positive>
      <Hsp_gaps>0</Hsp_gaps>
      <Hsp_align-len>30</Hsp_align-len>
      <Hsp_qseq>MERQKRKADIEKGLQFIQSTLPLKQEEYEA</Hsp_qseq>
      <Hsp_hseq>MERQKRKADIEKGLQFIQSTLPLKQEEYEA</Hsp_hseq>
      <Hsp_midline>MERQKRKADIEKGLQFIQSTLPLKQEEYEA</Hsp_midline>
    </Hsp>
  </Hit_hsps>
(...)
We want to insert that XML file into a database. I wrote the following XSLT stylesheet , it transforms the blast-xml into a set of SQL statements for sqlite3.
xsltproc --novalid blast2sqlite.xsl blast.xml 

create table BlastOutput(
(...)


BEGIN TRANSACTION;

insert into BlastOutput(
 program,
 version,
 reference,
 db,
 query_ID,
 query_def,
 query_len
 )
 values (
  'tblastn',
  'TBLASTN 2.2.27+',
  'Stephen F. Altschul, Thomas L. Madden, Alejandro A. Sch&auml;ffer, Jinghui Zhang,Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.',
  'nr',
  '52385',
  'myseq',
  30
  );


insert into Parameters(
 blastOutput_id,
 expect,
 matrix,
 sc_match,
 sc_mismatch,
 gap_open,
 gap_extend,
 filter
 )
select MAX(id),
 10,
 'BLOSUM62',
 NULL,
 NULL,
 11,
 1,
 'L;'
 from BlastOutput;
 


insert into Iteration(
 blastOutput_id,
 iter_num,
 query_id,
 query_def,
 query_len
 )
select MAX(id),
 1,
 '52385',
 'myseq',
 30
from BlastOutput;

insert into Hit(iteration_id,num,hit_id,def,accession,len)
select MAX(id),
 1,
 'gi|110624327|dbj|AK225891.1|',
 'Homo sapiens mRNA for zinc finger CCCH-type containing 7B variant, clone: FCC121C02',
 'AK225891',
 1829
from Iteration;
(...)
All in one you can redirect the output to sqlite3.
xsltproc --novalid blast2sqlite.xsl blast.xml |\
 sqlite3 input.db
and query the database:
$ sqlite3 -header -line input.sqlite \
 'select * from Hsp,Hit where Hsp.hit_id=Hit.id limit 2'

          id = 1
      hit_id = 1
         num = 1
   bit_score = 62.3882
       score = 150.0
      evalue = 4.01658e-10
  query_from = 1
    query_to = 30
    hit_from = 250
      hit_to = 339
 query_frame = 0
   hit_frame = 1
    identity = 30
    positive = 30
        gaps = 0
   align_len = 30
        qseq = MERQKRKADIEKGLQFIQSTLPLKQEEYEA
        hseq = MERQKRKADIEKGLQFIQSTLPLKQEEYEA
     midline = MERQKRKADIEKGLQFIQSTLPLKQEEYEA
          id = 1
iteration_id = 1
         num = 1
      hit_id = gi|110624327|dbj|AK225891.1|
         def = Homo sapiens mRNA for zinc finger CCCH-type containing 7B variant, clone: FCC121C02
   accession = AK225891
         len = 1829

          id = 2
      hit_id = 2
         num = 1
   bit_score = 62.3882
       score = 150.0
      evalue = 4.12279e-10
  query_from = 1
    query_to = 30
    hit_from = 105
      hit_to = 194
 query_frame = 0
   hit_frame = 3
    identity = 30
    positive = 30
        gaps = 0
   align_len = 30
        qseq = MERQKRKADIEKGLQFIQSTLPLKQEEYEA
        hseq = MERQKRKADIEKGLQFIQSTLPLKQEEYEA
     midline = MERQKRKADIEKGLQFIQSTLPLKQEEYEA
          id = 2
iteration_id = 1
         num = 2
      hit_id = gi|6176337|gb|AF188530.1|AF188530
         def = Homo sapiens ubiquitous tetratricopeptide containing protein RoXaN mRNA, partial cds
   accession = AF188530
         len = 2398
That's it,

Pierre

26 April 2013

Java JNI bindings for BWA(mem-lite)

Motivation

BWA 7.4(http://bio-bwa.sourceforge.net/) contains a small C example(https://github.com/lh3/bwa/blob/master/example.c) for running bwa-mem as a library (bwamem-lite). I created some JNI bindings to see if I can bind the C bwa library to java and get the same output than bwamem-lite. I put the code on github at https://github.com/lindenb/jbwa.

Example


(compare to https://github.com/lh3/bwa/blob/master/example.c )

System.loadLibrary("bwajni");
BwaIndex index=new BwaIndex(new File("hg19.fa"));
BwaMem mem=new BwaMem(index);
KSeq kseq=new KSeq(new File("input.fastq.gz");
ShortRead read=null;
while((read=kseq.next())!=null)
        {
        for(AlnRgn a: mem.align(read))
                {
                if(a.getSecondary()>=0) continue;
                System.out.println(  read.getName()+"\t"+  a.getStrand()+"\t"+  a.getChrom()+"\t"+
                        a.getPos()+"\t"+ a.getMQual()+"\t"+ a.getCigar()+"\t"+  a.getNm() );
                }
        }
kseq.dispose();
index.close();
mem.dispose();

Testing


Here is the ouput of the JAVA version:

gunzip -c input.fastq.gz | head -n 4000 |\
java  -Djava.library.path=src/main/native -cp src/main/java \
   com.github.lindenb.jbwa.jni.Example human_g1k_v37.fasta -| tail 


HWI-1KL149:20:C1CU7ACXX:4:1101:3077:33410       +       3       38647538        60      89M11S  1
HWI-1KL149:20:C1CU7ACXX:4:1101:3396:33445       +       8       52567289        60      100M    1
HWI-1KL149:20:C1CU7ACXX:4:1101:10013:33288      -       1       156104115       60      100M    1
HWI-1KL149:20:C1CU7ACXX:4:1101:10390:33496      -       6       123824853       60      100M    1
HWI-1KL149:20:C1CU7ACXX:4:1101:13537:33483      +       2       157367092       60      100M    1
HWI-1KL149:20:C1CU7ACXX:4:1101:14139:33390      +       20      31413797        60      100M    1
HWI-1KL149:20:C1CU7ACXX:4:1101:14514:33458      +       2       179401813       60      100M    1
HWI-1KL149:20:C1CU7ACXX:4:1101:15292:33282      +       15      63335820        60      100M    1
HWI-1KL149:20:C1CU7ACXX:4:1101:16960:33276      -       12      110782784       60      100M    1
HWI-1KL149:20:C1CU7ACXX:4:1101:17355:33322      +       6       126077895       60      100M    1

And the ouput of the Native C version:

gunzip -c input.fastq.gz | head -n 4000 |\
bwa-0.7.4/bwamem-lite human_g1k_v37.fasta - | tail 

HWI-1KL149:20:C1CU7ACXX:4:1101:3077:33410       +       3       38647538        60      89M11S  1
HWI-1KL149:20:C1CU7ACXX:4:1101:3396:33445       +       8       52567289        60      100M    1
HWI-1KL149:20:C1CU7ACXX:4:1101:10013:33288      -       1       156104115       60      100M    1
HWI-1KL149:20:C1CU7ACXX:4:1101:10390:33496      -       6       123824853       60      100M    1
HWI-1KL149:20:C1CU7ACXX:4:1101:13537:33483      +       2       157367092       60      100M    1
HWI-1KL149:20:C1CU7ACXX:4:1101:14139:33390      +       20      31413797        60      100M    1
HWI-1KL149:20:C1CU7ACXX:4:1101:14514:33458      +       2       179401813       60      100M    1
HWI-1KL149:20:C1CU7ACXX:4:1101:15292:33282      +       15      63335820        60      100M    1
HWI-1KL149:20:C1CU7ACXX:4:1101:16960:33276      -       12      110782784       60      100M    1
HWI-1KL149:20:C1CU7ACXX:4:1101:17355:33322      +       6       126077895       60      100M    1

GUI


As a test I also created a swing-Based interface for BWA:

java  -Djava.library.path=src/main/native  -cp src/main/java \
    com.github.lindenb.jbwa.jni.BwaFrame human_g1k_v37.fasta



That's it,


Pierre

23 April 2013

playing with BWA-MEM : my notebook

BWA-MEM, is a new tool that is part of the latest version of BWA. As said Heng Li on Biostar bwa-mem can be used to identify the viral integration sites in the human genome. Here I've used various short reads to explore how bwa maps the pairs. The sequences I used below are:

  • NOTCH2a and NOTCH2b two sequences on the chromosomes 1, on the same strand
  • NOTCH2del : same as NOTCH2a but with a deletion
  • ROXAN1a and ROXAN1b: two sequences on the chromosome 22, on the same strand
  • NOTCH2ins is NOTCH2a with and insertion of ROXAN1a
The following results were generated with the makefile below. Each pair of fastq was submitted twice (1_* and 2_*). I also added some pairs of reads from another source of FASTQs to let bwa infer the size of the fragments (see biostar: http://www.biostars.org/p/69694).

NOTCH2a vs NOTCH2b BWA-MEM options: none

NOTCH2a vs NOTCH2b
BWA-MEM options: none
NOT Properly mapped reads because they're on the same strand.
ReadFlagChromPosqualCigarExtra
1_Notch2p1=651120572000950MNM:i:0 AS:i:50 XS:i:45
1_Notch2p2=1291120572200950MNM:i:0 AS:i:50 XS:i:45
2_Notch2p11120572000950MNM:i:0 AS:i:50 XS:i:45
2_Notch2p21120572200950MNM:i:0 AS:i:50 XS:i:45

NOTCH2a vs revcomp(NOTCH2b) BWA-MEM options: none

NOTCH2a vs revcomp(NOTCH2b)
BWA-MEM options: none
Properly mapped reads.
ReadFlagChromPosqualCigarExtra
1_Notch2pPR1=9911205720003950MNM:i:0 AS:i:50 XS:i:45
1_Notch2pPr2=14711205722003950MNM:i:0 AS:i:50 XS:i:45
2_Notch2pPR111205720003950MNM:i:0 AS:i:50 XS:i:45
2_Notch2pPr211205722003950MNM:i:0 AS:i:50 XS:i:45

NOTCH2del vs revcomp(NOTCH2b) BWA-MEM options: none

NOTCH2del vs revcomp(NOTCH2b)
BWA-MEM options: none
Deletion in Read1
ReadFlagChromPosqualCigarExtra
1_Notch2delpPR1=9911205720003937M20D31MNM:i:20 AS:i:42 XS:i:37
1_Notch2delpPr2=14711205722003950MNM:i:0 AS:i:50 XS:i:45
2_Notch2delpPR111205720003937M20D31MNM:i:20 AS:i:42 XS:i:37
2_Notch2delpPr211205722003950MNM:i:0 AS:i:50 XS:i:45

NOTCH2ins vs revcomp(NOTCH2b) BWA-MEM options:

NOTCH2ins vs revcomp(NOTCH2b)
BWA-MEM options: non
Soft clipping of chr1: two hits on different chromosomes.
ReadFlagChromPosqualCigarExtra
1_NOTCH2insRoxanpR1=9722417215666023S50M27SNM:i:0 AS:i:50 XS:i:0
1_NOTCH2insRoxanpr2=1451120572200950MNM:i:0 AS:i:50 XS:i:45
2_NOTCH2insRoxanpR122417215666023S50M27SNM:i:0 AS:i:50 XS:i:0
2_NOTCH2insRoxanpr21120572200950MNM:i:0 AS:i:50 XS:i:45


NOTCH2a+ROXAN1a vs revcomp(NOTCH2b) BWA-MEM options: none

NOTCH2a+ROXAN1a vs revcomp(NOTCH2b)
BWA-MEM options: none
two hits on chromosome chr1 and chr22 for the 5' seq
nevertheless, properly paired was set.
ReadFlagChromPosqualCigarExtra
1_Notch2RoxanpPR1=991120572000950M50SNM:i:0 AS:i:50 XS:i:45 XP:Z:22,+41721566,50S50M,9,0;
1_Notch2RoxanpPR1=992241721566950S50MNM:i:0 AS:i:50 XS:i:0 XP:Z:1,+120572000,50M50S,9,0;
1_Notch2RoxanpPr2=1471120572200950MNM:i:0 AS:i:50 XS:i:45
2_Notch2RoxanpPR11120572000950M50SNM:i:0 AS:i:50 XS:i:45 XP:Z:22,+41721566,50S50M,9,0;
2_Notch2RoxanpPR12241721566950S50MNM:i:0 AS:i:50 XS:i:0 XP:Z:1,+120572000,50M50S,9,0;
2_Notch2RoxanpPr21120572200950MNM:i:0 AS:i:50 XS:i:45

NOTCH2a+ROXAN1a vs revcomp(NOTCH2b+ROXAN1b) BWA-MEM options: none

NOTCH2a+ROXAN1a vs revcomp(NOTCH2b+ROXAN1b)
BWA-MEM options: none
All fragments on chr1/chr22.
Reads are NOT properly paired.
ReadFlagChromPosqualCigarExtra
1_Notch2RoxanpR1=971120572000950M50SNM:i:0 AS:i:50 XS:i:45 XP:Z:22,+41721566,50S50M,9,0;
1_Notch2RoxanpR1=972241721566950S50MNM:i:0 AS:i:50 XS:i:0 XP:Z:1,+120572000,50M50S,9,0;
1_Notch2Roxanpr2=14522417217666050S50MNM:i:0 AS:i:50 XS:i:0 XP:Z:1,-120572200,50M50S,9,0;
1_Notch2Roxanpr2=1451120572200950M50SNM:i:0 AS:i:50 XS:i:45 XP:Z:22,-41721766,50S50M,60,0;
2_Notch2RoxanpR11120572000950M50SNM:i:0 AS:i:50 XS:i:45 XP:Z:22,+41721566,50S50M,9,0;
2_Notch2RoxanpR12241721566950S50MNM:i:0 AS:i:50 XS:i:0 XP:Z:1,+120572000,50M50S,9,0;
2_Notch2Roxanpr222417217666050S50MNM:i:0 AS:i:50 XS:i:0 XP:Z:1,-120572200,50M50S,9,0;
2_Notch2Roxanpr21120572200950M50SNM:i:0 AS:i:50 XS:i:45 XP:Z:22,-41721766,50S50M,60,0;

NOTCH2a+ROXAN1a vs revcomp(NOTCH2b) BWA-MEM options: -C

NOTCH2a+ROXAN1a vs revcomp(NOTCH2b)
BWA-MEM options: -C
I cannot see the effect of the option '-C':
"append FASTA/FASTQ comment to SAM output"
ReadFlagChromPosqualCigarExtra
1_Notch2RoxanpPR1=991120572000950M50SNM:i:0 AS:i:50 XS:i:45 XP:Z:22,+41721566,50S50M,9,0;
1_Notch2RoxanpPR1=992241721566950S50MNM:i:0 AS:i:50 XS:i:0 XP:Z:1,+120572000,50M50S,9,0;
1_Notch2RoxanpPr2=1471120572200950MNM:i:0 AS:i:50 XS:i:45
2_Notch2RoxanpPR11120572000950M50SNM:i:0 AS:i:50 XS:i:45 XP:Z:22,+41721566,50S50M,9,0;
2_Notch2RoxanpPR12241721566950S50MNM:i:0 AS:i:50 XS:i:0 XP:Z:1,+120572000,50M50S,9,0;
2_Notch2RoxanpPr21120572200950MNM:i:0 AS:i:50 XS:i:45

NOTCH2a+ROXAN1a vs revcomp(NOTCH2b) BWA-MEM options: -M

NOTCH2a+ROXAN1a vs revcomp(NOTCH2b)
BWA-MEM options: -M
Set the duplicate flags for the multiple hits.
ReadFlagChromPosqualCigarExtra
1_Notch2RoxanpPR1=991120572000950M50SNM:i:0 AS:i:50 XS:i:45 XP:Z:22,+41721566,50S50M,9,0;
1_Notch2RoxanpPR1s=3552241721566950S50MNM:i:0 AS:i:50 XS:i:0 XP:Z:1,+120572000,50M50S,9,0;
1_Notch2RoxanpPr21120572200950MNM:i:0 AS:i:50 XS:i:45
2_Notch2RoxanpPR11120572000950M50SNM:i:0 AS:i:50 XS:i:45 XP:Z:22,+41721566,50S50M,9,0;
2_Notch2RoxanpPR1s2241721566950S50MNM:i:0 AS:i:50 XS:i:0 XP:Z:1,+120572000,50M50S,9,0;
2_Notch2RoxanpPr21120572200950MNM:i:0 AS:i:50 XS:i:45

NOTCH2ins vs revcomp(ROXAN1b) BWA-MEM options: none

NOTCH2ins vs revcomp(ROXAN1b)
BWA-MEM options: none
Reads are mapped on chr22.
ReadFlagChromPosqualCigarExtra
1_NOTCH2insRoxanpPR122417215666023S50M27SNM:i:0 AS:i:50 XS:i:0
1_NOTCH2insRoxanpPr222417217666050MNM:i:0 AS:i:50 XS:i:0
2_NOTCH2insRoxanpPR122417215666023S50M27SNM:i:0 AS:i:50 XS:i:0
2_NOTCH2insRoxanpPr222417217666050MNM:i:0 AS:i:50 XS:i:0

That's it,

Pierre

The makefile